PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019365.1
Common NamePI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22876.4 Da    PI: 9.8523
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019365.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.51e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvtfskRrngi+KKA E+SvLCda+v+v+ifss+gk+ ey+s
  Aco019365.1  9 KRIENSTNRQVTFSKRRNGIIKKAREISVLCDAQVSVVIFSSSGKMSEYCS 59
                 79***********************************************96 PP

2K-box81.61.8e-2771169199
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  yq++sgk+l++ak+e+l+ e++++kke++n+q e+Rh++GedL+sL  keL  +e++L+++l+ +R+k++++l+++ ++ +  e+e+++   +L+++ 
  Aco019365.1  71 YQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHMKGEDLNSLHPKELIPIEEALQNGLTVVRDKQMDYLRMMKKNGRLLEEENKQLAFMLHHQE 168
                  899*******************************************************************************************9987 PP

        K-box  99 e 99 
                  +
  Aco019365.1 169 M 169
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.38161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-37296IPR002100Transcription factor, MADS-box
CDDcd002659.20E-44280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-1882164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.75184170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRNGIIK KAREISVLCD AQVSVVIFSS SGKMSEYCSP  60
STTLPKLLEK YQQNSGKKLW DAKHENLSAE IDRIKKENDN MQIELRHMKG EDLNSLHPKE  120
LIPIEEALQN GLTVVRDKQM DYLRMMKKNG RLLEEENKQL AFMLHHQEMA MNGNMREPQI  180
PMGFRVQPIQ PNLQEDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-18273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-18273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-18273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-18273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-18273170Myocyte-specific enhancer factor 2A
3kov_B2e-18273170Myocyte-specific enhancer factor 2A
3kov_I2e-18273170Myocyte-specific enhancer factor 2A
3kov_J2e-18273170Myocyte-specific enhancer factor 2A
3mu6_A1e-18271168Myocyte-specific enhancer factor 2A
3mu6_B1e-18271168Myocyte-specific enhancer factor 2A
3mu6_C1e-18271168Myocyte-specific enhancer factor 2A
3mu6_D1e-18271168Myocyte-specific enhancer factor 2A
3p57_A2e-18273170Myocyte-specific enhancer factor 2A
3p57_B2e-18273170Myocyte-specific enhancer factor 2A
3p57_C2e-18273170Myocyte-specific enhancer factor 2A
3p57_D2e-18273170Myocyte-specific enhancer factor 2A
3p57_I2e-18273170Myocyte-specific enhancer factor 2A
3p57_J2e-18273170Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7177960.0HQ717796.1 Ananas comosus PISTILLATA-like protein (PI) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010905324.11e-118PREDICTED: MADS-box transcription factor 2-like
SwissprotQ407022e-99MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLH6TB711e-145H6TB71_ANACO; PISTILLATA-like protein
STRINGGSMUA_Achr5P01230_0011e-116(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.13e-88MIKC_MADS family protein
Publications ? help Back to Top
  1. Lv LL, et al.
    Cloning and expression analysis of a PISTILLATA homologous gene from pineapple (Ananas comosus L. Merr).
    Int J Mol Sci, 2012. 13(1): p. 1039-53
    [PMID:22312303]